PDB entry 1cj1

View 1cj1 on RCSB PDB site
Description: growth factor receptor binding protein sh2 domain (human) complexed with a phosphotyrosyl derivative
Class: signaling protein
Keywords: signal transduction, sh2 domain, phosphotyrosine, signaling protein
Deposited on 1999-04-21, released 1999-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1a_
  • Chain 'B':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1b_
  • Chain 'C':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1c_
  • Chain 'D':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1d_
  • Chain 'E':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1e_
  • Chain 'F':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1f_
  • Chain 'G':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1g_
  • Chain 'H':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1h_
  • Chain 'I':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1i_
  • Chain 'J':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1j_
  • Chain 'K':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1k_
  • Chain 'L':
    Compound: protein (growth factor receptor-bound protein 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cj1l_
  • Heterogens: C78, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1A (A:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1B (B:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1C (C:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1D (D:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1E (E:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1F (F:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1G (G:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1H (H:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1I (I:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1J (J:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1K (K:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cj1L (L:)
    phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
    kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie