SCOPe 2.08: Domain d7cbze_: 7cbz E:

Lineage for d7cbze_ (7cbz E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d7cbze_: 7cbz E: [404764]
   Other proteins in same PDB: d7cbza1, d7cbza2, d7cbzb1, d7cbzb2, d7cbzc1, d7cbzc2, d7cbzd1, d7cbzd2, d7cbzf1, d7cbzf2
   automated match to d4i55e_
   complexed with ca, fuo, gdp, gtp, mes, mg

Details for d7cbze_

PDB Entry: 7cbz, 2.61 Å

PDB Description: crystal structure of t2r-ttl-a31 complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7cbze_:

Sequence, based on SEQRES records:

>d7cbze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d7cbze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d7cbze_:

• d7cbze_ first appeared in SCOPe 2.07