SCOPe 2.08: Domain d7cbzb1: 7cbz B:2-245

Lineage for d7cbzb1 (7cbz B:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d7cbzb1: 7cbz B:2-245 [404700]
   Other proteins in same PDB: d7cbza2, d7cbzb2, d7cbzc2, d7cbzd2, d7cbze_, d7cbzf1, d7cbzf2
   automated match to d4drxb1
   complexed with ca, fuo, gdp, gtp, mes, mg

Details for d7cbzb1

PDB Entry: 7cbz, 2.61 Å

PDB Description: crystal structure of t2r-ttl-a31 complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d7cbzb1:

Sequence; same for both SEQRES and ATOM records:

>d7cbzb1 c.32.1.1 (B:2-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d7cbzb1:

• d7cbzb1 first appeared in SCOPe 2.07