Lineage for d7awer_ (7awe R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2601273Species Human (Homo sapiens) [TaxId:9606] [311423] (24 PDB entries)
  8. 2601305Domain d7awer_: 7awe R: [404624]
    Other proteins in same PDB: d7awea_, d7aweb_, d7awec_, d7awef_, d7aweg_, d7aweh_, d7awej_, d7awem_, d7awen_, d7aweo_, d7awep_, d7awet_, d7aweu_, d7awev_, d7awex_
    automated match to d1irud_
    complexed with na, s5k, scn

Details for d7awer_

PDB Entry: 7awe (more details), 2.29 Å

PDB Description: human immunoproteasome 20s particle in complex with [(1r)-2-(1- benzofuran-3-yl)-1-{[(1s,2r,4r)-7-oxabicyclo[2.2.1]heptan-2- yl]formamido}ethyl]boronic acid
PDB Compounds: (R:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d7awer_:

Sequence, based on SEQRES records: (download)

>d7awer_ d.153.1.4 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee

Sequence, based on observed residues (ATOM records): (download)

>d7awer_ d.153.1.4 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekaklqdertvrkica
lddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqsngr
rpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeaietd
dltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee

SCOPe Domain Coordinates for d7awer_:

Click to download the PDB-style file with coordinates for d7awer_.
(The format of our PDB-style files is described here.)

Timeline for d7awer_: