SCOPe 2.04: Domain d1aotf_: 1aot F:

Lineage for d1aotf_ (1aot F:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Tyrosine kinase Fyn [55559] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55560] (3 PDB entries)

8. Domain d1aotf_: 1aot F: [40458]

Details for d1aotf_

PDB Entry: 1aot

PDB Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure

PDB Compounds: (F:) fyn protein-tyrosine kinase

SCOPe Domain Sequences for d1aotf_:

Sequence; same for both SEQRES and ATOM records:

>d1aotf_ d.93.1.1 (F:) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk

Timeline for d1aotf_:

• d1aotf_ first appeared (with stable ids) in SCOP 1.55
  
• d1aotf_ appears in SCOPe 2.03
  
• d1aotf_ appears in SCOPe 2.05
  
• d1aotf_ appears in the current release, SCOPe 2.08