Lineage for d1aotf_ (1aot F:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34670Protein Tyrosine kinase Fyn [55559] (1 species)
  7. 34671Species Human (Homo sapiens) [TaxId:9606] [55560] (2 PDB entries)
  8. 34672Domain d1aotf_: 1aot F: [40458]

Details for d1aotf_

PDB Entry: 1aot (more details)

PDB Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure

SCOP Domain Sequences for d1aotf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aotf_ d.93.1.1 (F:) Tyrosine kinase Fyn {Human (Homo sapiens)}
siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk

SCOP Domain Coordinates for d1aotf_:

Click to download the PDB-style file with coordinates for d1aotf_.
(The format of our PDB-style files is described here.)

Timeline for d1aotf_: