Lineage for d1f2fa_ (1f2f A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918740Protein c-src tyrosine kinase [55556] (3 species)
  7. 1918741Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries)
  8. 1918744Domain d1f2fa_: 1f2f A: [40455]
    complexed with po4; mutant

Details for d1f2fa_

PDB Entry: 1f2f (more details), 1.7 Å

PDB Description: src sh2 thref1trp mutant
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1f2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2fa_ d.93.1.1 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt

SCOPe Domain Coordinates for d1f2fa_:

Click to download the PDB-style file with coordinates for d1f2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f2fa_: