SCOPe 2.06: Domain d1f2fa_: 1f2f A:

Lineage for d1f2fa_ (1f2f A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries)

8. Domain d1f2fa_: 1f2f A: [40455]
   complexed with po4; mutant

Details for d1f2fa_

PDB Entry: 1f2f, 1.7 Å

PDB Description: src sh2 thref1trp mutant

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1f2fa_:

Sequence; same for both SEQRES and ATOM records:

>d1f2fa_ d.93.1.1 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt

Timeline for d1f2fa_:

• d1f2fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2fa_ appears in SCOPe 2.05
  
• d1f2fa_ appears in SCOPe 2.07
  
• d1f2fa_ appears in the current release, SCOPe 2.08