SCOPe 2.07: Domain d6ztri1: 6ztr I:109-208

Lineage for d6ztri1 (6ztr I:109-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (18 PDB entries)

8. Domain d6ztri1: 6ztr I:109-208 [404347]
   Other proteins in same PDB: d6ztrb1, d6ztrb2, d6ztrl1, d6ztrl2
   automated match to d1ff5a1
   complexed with ca

Details for d6ztri1

PDB Entry: 6ztr, 2.1 Å

PDB Description: crystal structure of the anti-human p-cadherin fab cqy684 in complex with human p-cadherin(108-324)

PDB Compounds: (I:) Cadherin-3

SCOPe Domain Sequences for d6ztri1:

Sequence; same for both SEQRES and ATOM records:

>d6ztri1 b.1.6.0 (I:109-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwll
lnkpldreeiakyelfghavsengasvedpmnisiivtdq

Timeline for d6ztri1:

• d6ztri1 is new in SCOPe 2.07-stable
  
• d6ztri1 appears in the current release, SCOPe 2.08