Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (3 families) |
Family b.1.6.0: automated matches [191376] (1 protein) not a true family |
Protein automated matches [190458] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255601] (18 PDB entries) |
Domain d6ztri1: 6ztr I:109-208 [404347] Other proteins in same PDB: d6ztrb1, d6ztrb2, d6ztrl1, d6ztrl2 automated match to d1ff5a1 complexed with ca |
PDB Entry: 6ztr (more details), 2.1 Å
SCOPe Domain Sequences for d6ztri1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ztri1 b.1.6.0 (I:109-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} wvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwll lnkpldreeiakyelfghavsengasvedpmnisiivtdq
Timeline for d6ztri1: