Lineage for d1ff5a1 (1ff5 A:-1-101)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373405Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2373406Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2373414Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2373437Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2373477Domain d1ff5a1: 1ff5 A:-1-101 [22202]
    two-domain fragment
    complexed with ca

Details for d1ff5a1

PDB Entry: 1ff5 (more details), 2.93 Å

PDB Description: structure of e-cadherin double domain
PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d1ff5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff5a1 b.1.6.1 (A:-1-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
mdwvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgw
lkvtqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d1ff5a1:

Click to download the PDB-style file with coordinates for d1ff5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ff5a1:

2373477
d1ff5a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ff5a2