Lineage for d6yv6a1 (6yv6 A:1-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798549Species Staphylococcus aureus [TaxId:93061] [193276] (7 PDB entries)
  8. 2798550Domain d6yv6a1: 6yv6 A:1-204 [404206]
    Other proteins in same PDB: d6yv6a2
    automated match to d4inka_
    complexed with 1pe, peg

Details for d6yv6a1

PDB Entry: 6yv6 (more details), 1.36 Å

PDB Description: crystal structure of serine protease splb n2k/n3q/s154r from staphylococcus aureus
PDB Compounds: (A:) serine protease

SCOPe Domain Sequences for d6yv6a1:

Sequence, based on SEQRES records: (download)

>d6yv6a1 b.47.1.0 (A:1-204) automated matches {Staphylococcus aureus [TaxId: 93061]}
ekqvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtergnsgspvlnsnnelvgihfasdvknd
dnrnaygvyftpeikkfiaenidk

Sequence, based on observed residues (ATOM records): (download)

>d6yv6a1 b.47.1.0 (A:1-204) automated matches {Staphylococcus aureus [TaxId: 93061]}
ekqvtkvkdtnifpytgvvafksatgfvvgkntiltnkhvsknykvgdritahpnsdkgn
ggiysikkiinypgkedvsviqveeraiergpkgfnfndnvtpfkyaagakagerikvig
yphpyknkyvlyestgpvmsvegssivysahtergnsgspvlnsnnelvgihfasdrnay
gvyftpeikkfiaenidk

SCOPe Domain Coordinates for d6yv6a1:

Click to download the PDB-style file with coordinates for d6yv6a1.
(The format of our PDB-style files is described here.)

Timeline for d6yv6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6yv6a2