Lineage for d4inka_ (4ink A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798549Species Staphylococcus aureus [TaxId:93061] [193276] (7 PDB entries)
  8. 2798559Domain d4inka_: 4ink A: [234887]
    automated match to d4inla_

Details for d4inka_

PDB Entry: 4ink (more details), 1.56 Å

PDB Description: crystal structure of spld protease from staphylococcus aureus at 1.56 a resolution
PDB Compounds: (A:) Serine protease SplD

SCOPe Domain Sequences for d4inka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inka_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
ensvklitntnvapysgvtwmgagtgfvvgnhtiitnkhvtyhmkvgdeikahpngfynn
ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy
pnpngnklqmyestgkvlsvngnivtsdavvqpgssgspilnskreaigvmyasdkptge
strsfavyfspeikkfiadnldk

SCOPe Domain Coordinates for d4inka_:

Click to download the PDB-style file with coordinates for d4inka_.
(The format of our PDB-style files is described here.)

Timeline for d4inka_: