Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [193276] (7 PDB entries) |
Domain d4inka_: 4ink A: [234887] automated match to d4inla_ |
PDB Entry: 4ink (more details), 1.56 Å
SCOPe Domain Sequences for d4inka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4inka_ b.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]} ensvklitntnvapysgvtwmgagtgfvvgnhtiitnkhvtyhmkvgdeikahpngfynn ggglykvtkivdypgkediavvqveekstqpkgrkfkdftskfniaseakenepisvigy pnpngnklqmyestgkvlsvngnivtsdavvqpgssgspilnskreaigvmyasdkptge strsfavyfspeikkfiadnldk
Timeline for d4inka_: