Lineage for d6yr3e_ (6yr3 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835294Species Thermoplasma acidophilum [TaxId:273075] [189712] (12 PDB entries)
  8. 2835299Domain d6yr3e_: 6yr3 E: [404155]
    automated match to d3s1xa_
    complexed with act, f6r, gol

Details for d6yr3e_

PDB Entry: 6yr3 (more details), 1.48 Å

PDB Description: 1.48 angstrom resolution crystal structure of transaldolase from thermoplasma acidophilum in complex with d-fructose 6-phosphate schiff-base intermediate
PDB Compounds: (E:) Probable transaldolase

SCOPe Domain Sequences for d6yr3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yr3e_ c.1.10.1 (E:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mkifldtanideirtgvnwgivdgvttnptliskeavngkkygdiireilkivdgpvsve
vvstkyegmveearkihglgdnavvkipmtedglraiktlssehintnctlvfnpiqall
aakagvtyvspfvgrlddigedgmqiidmirtifnnyiiktqilvasirnpihvlrsavi
gadvvtvpfnvlkslmkhpktdeglakfledwkkvspdgklil

SCOPe Domain Coordinates for d6yr3e_:

Click to download the PDB-style file with coordinates for d6yr3e_.
(The format of our PDB-style files is described here.)

Timeline for d6yr3e_: