SCOPe 2.07: Domain d1mmpa_: 1mmp A:

Lineage for d1mmpa_ (1mmp A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Matrilysin (MMP-7) [55538] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55539] (3 PDB entries)

8. Domain d1mmpa_: 1mmp A: [40397]
   complexed with ca, rss, zn

Details for d1mmpa_

PDB Entry: 1mmp, 2.3 Å

PDB Description: matrilysin complexed with carboxylate inhibitor

PDB Compounds: (A:) gelatinase a

SCOPe Domain Sequences for d1mmpa_:

Sequence; same for both SEQRES and ATOM records:

>d1mmpa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk

Timeline for d1mmpa_:

• d1mmpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1mmpa_ appears in SCOPe 2.06
  
• d1mmpa_ appears in the current release, SCOPe 2.08