SCOPe 2.01: Domain d1c8ta_: 1c8t A:

Lineage for d1c8ta_ (1c8t A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (37 PDB entries)

8. Domain d1c8ta_: 1c8t A: [40390]
   complexed with ca, tr1, zn

Details for d1c8ta_

PDB Entry: 1c8t, 2.6 Å

PDB Description: human stromelysin-1 (e202q) catalytic domain complexed with ro-26-2812

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1c8ta_:

Sequence; same for both SEQRES and ATOM records:

>d1c8ta_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp

Timeline for d1c8ta_:

• d1c8ta_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8ta_ appears in SCOP 1.75
  
• d1c8ta_ appears in SCOPe 2.02
  
• d1c8ta_ appears in the current release, SCOPe 2.08