Lineage for d1c8ta_ (1c8t A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34427Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins)
  6. 34480Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 34481Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries)
  8. 34506Domain d1c8ta_: 1c8t A: [40390]

Details for d1c8ta_

PDB Entry: 1c8t (more details), 2.6 Å

PDB Description: human stromelysin-1 (e202q) catalytic domain complexed with ro-26-2812

SCOP Domain Sequences for d1c8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ta_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
fpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimis
favrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahqigh
slglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdp

SCOP Domain Coordinates for d1c8ta_:

Click to download the PDB-style file with coordinates for d1c8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1c8ta_: