SCOPe 2.08: Domain d7nhoh_: 7nho H:

Lineage for d7nhoh_ (7nho H:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
   Uniprot Q8DJ43 2-65

8. Domain d7nhoh_: 7nho H: [403819]
   Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
   automated match to d2axth1
   complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhoh_

PDB Entry: 7nho, 2.66 Å

PDB Description: structure of psii-m

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7nhoh_:

Sequence; same for both SEQRES and ATOM records:

>d7nhoh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d7nhoh_:

• d7nhoh_ first appeared in SCOPe 2.07