SCOPe 2.08: Domain d7nhph_: 7nhp H:

Lineage for d7nhph_ (7nhp H:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
   Uniprot Q8DJ43 2-65

8. Domain d7nhph_: 7nhp H: [403784]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d2axth1
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhph_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7nhph_:

Sequence; same for both SEQRES and ATOM records:

>d7nhph_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d7nhph_:

• d7nhph_ first appeared in SCOPe 2.07