SCOPe 2.07: Domain d7nhqc_: 7nhq C:

Lineage for d7nhqc_ (7nhq C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries)

8. Domain d7nhqc_: 7nhq C: [403781]
   Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_
   automated match to d5b66c_
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqc_

PDB Entry: 7nhq, 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d7nhqc_:

Sequence; same for both SEQRES and ATOM records:

>d7nhqc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg
liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss
ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld
prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi
wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg
anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq
pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha
graraaaagfek

Timeline for d7nhqc_:

• d7nhqc_ is new in SCOPe 2.07-stable
  
• d7nhqc_ appears in the current release, SCOPe 2.08