Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (14 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
Domain d7nhqa_: 7nhq A: [403755] Other proteins in same PDB: d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_ automated match to d2axta1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhq (more details), 2.68 Å
SCOPe Domain Sequences for d7nhqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhqa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida kgnvintwadiinranlgmevmhernahnfpldla
Timeline for d7nhqa_: