SCOP 1.61: Domain d2usn__: 2usn -

Lineage for d2usn__ (2usn -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)

8. Domain d2usn__: 2usn - [40376]

Details for d2usn__

PDB Entry: 2usn, 2.2 Å

PDB Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with thiadiazole inhibitor pnu-141803

SCOP Domain Sequences for d2usn__:

Sequence; same for both SEQRES and ATOM records:

>d2usn__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslyg

Timeline for d2usn__:

• d2usn__ first appeared (with stable ids) in SCOP 1.55
  
• d2usn__ appears in SCOP 1.59
  
• d2usn__ appears in SCOP 1.63
  
• d2usn__ appears in the current release, SCOPe 2.08, called d2usna_