PDB entry 2usn

View 2usn on RCSB PDB site
Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with thiadiazole inhibitor pnu-141803
Deposited on 1998-06-09, released 1998-12-23
The last revision prior to the SCOP 1.61 freeze date was dated 1998-12-23, with a file datestamp of 1998-12-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d2usn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2usn_ (-)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslyg