Lineage for d1umsa_ (1ums A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d1umsa_: 1ums A: [40368]
Details for d1umsa_
PDB Entry: 1ums (more details)
PDB Description: stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr ensemble of 20 structures
SCOP Domain Sequences for d1umsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umsa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygp
SCOP Domain Coordinates for d1umsa_:
Click to download the PDB-style file with coordinates for d1umsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1umsa_:
- d1umsa_ first appeared (with stable ids) in SCOP 1.55
- d1umsa_ appears in SCOP 1.59
- d1umsa_ appears in SCOP 1.63
- d1umsa_ appears in the current release, SCOPe 2.08
View in 3D