PDB entry 1ums

View 1ums on RCSB PDB site
Description: stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr ensemble of 20 structures
Deposited on 1995-10-31, released 1996-03-08
The last revision prior to the SCOP 1.61 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1umsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1umsA (A:)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygp