Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) |
Domain d1ueaa_: 1uea A: [40365] Other proteins in same PDB: d1ueab_, d1uead_ |
PDB Entry: 1uea (more details), 2.8 Å
SCOP Domain Sequences for d1ueaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueaa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
Timeline for d1ueaa_: