Lineage for d1uead_ (1uea D:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.3: TIMP-like [50242] (2 families) 
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) 
Protein TIMP-1 [50244] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50245] (2 PDB entries) 
Domain d1uead_: 1uea D: [25233]
Other proteins in same PDB: d1ueaa_, d1ueac_
Details for d1uead_
PDB Entry: 1uea (more details), 2.8 Å
PDB Description: mmp-3/timp-1 complex
SCOP Domain Sequences for d1uead_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uead_ b.40.3.1 (D:) TIMP-1 {Human (Homo sapiens)}
ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
s
SCOP Domain Coordinates for d1uead_:
Click to download the PDB-style file with coordinates for d1uead_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uead_:
- d1uead_ first appeared (with stable ids) in SCOP 1.55
- d1uead_ appears in SCOP 1.59
- d1uead_ appears in SCOP 1.63
- d1uead_ appears in the current release, SCOPe 2.08
View in 3D
