SCOP 1.59: Domain d1japa_: 1jap A:

Lineage for d1japa_ (1jap A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)

6. Protein Neutrophil collagenase (MMP-8) [55532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55533] (14 PDB entries)

8. Domain d1japa_: 1jap A: [40349]

Details for d1japa_

PDB Entry: 1jap, 1.82 Å

PDB Description: complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (met80 form)

SCOP Domain Sequences for d1japa_:

Sequence; same for both SEQRES and ATOM records:

>d1japa_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d1japa_:

• d1japa_ first appeared (with stable ids) in SCOP 1.55
  
• d1japa_ appears in SCOP 1.57
  
• d1japa_ appears in SCOP 1.61
  
• d1japa_ appears in the current release, SCOPe 2.08