Lineage for d1bswa_ (1bsw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964140Protein Snake venom metalloprotease [55520] (7 species)
  7. 2964148Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries)
  8. 2964150Domain d1bswa_: 1bsw A: [40329]
    complexed with ca, zn

Details for d1bswa_

PDB Entry: 1bsw (more details), 1.95 Å

PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5
PDB Compounds: (A:) protein (acutolysin a)

SCOPe Domain Sequences for d1bswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiakenppciln

SCOPe Domain Coordinates for d1bswa_:

Click to download the PDB-style file with coordinates for d1bswa_.
(The format of our PDB-style files is described here.)

Timeline for d1bswa_: