![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) ![]() |
![]() | Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
![]() | Protein Snake venom metalloprotease [55520] (4 species) |
![]() | Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries) |
![]() | Domain d1bswa_: 1bsw A: [40329] |
PDB Entry: 1bsw (more details), 1.95 Å
SCOP Domain Sequences for d1bswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A} fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy iqcrdyiakenppciln
Timeline for d1bswa_: