PDB entry 1bsw

View 1bsw on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5
Class: metal binding protein
Keywords: metalloproteinase, snake venom, mmp, metal binding protein
Deposited on 1998-08-31, released 1999-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (acutolysin a)
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bswa_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bswA (A:)
    fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
    lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
    gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
    iqcrdyiakenppciln