SCOP 1.73: Domain d1dtha_: 1dth A:

Lineage for d1dtha_ (1dth A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
   Pfam PF01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)

8. Domain d1dtha_: 1dth A: [40324]

Details for d1dtha_

PDB Entry: 1dth, 2 Å

PDB Description: metalloprotease

PDB Compounds: (A:) atrolysin c

SCOP Domain Sequences for d1dtha_:

Sequence; same for both SEQRES and ATOM records:

>d1dtha_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

Timeline for d1dtha_:

• d1dtha_ first appeared (with stable ids) in SCOP 1.55
  
• d1dtha_ appears in SCOP 1.71
  
• d1dtha_ appears in SCOP 1.75
  
• d1dtha_ appears in the current release, SCOPe 2.08