Lineage for d1dtha_ (1dth A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) 
Domain d1dtha_: 1dth A: [40324]
Details for d1dtha_
PDB Entry: 1dth (more details), 2 Å
PDB Description: metalloprotease
SCOP Domain Sequences for d1dtha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtha_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp
SCOP Domain Coordinates for d1dtha_:
Click to download the PDB-style file with coordinates for d1dtha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dtha_:
- d1dtha_ appears in SCOP 1.57
- d1dtha_ appears in the current release, SCOPe 2.08
View in 3D
