Lineage for d1dthb_ (1dth B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729294Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
    Pfam PF01421
  6. 729299Protein Snake venom metalloprotease [55520] (7 species)
  7. 729319Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 729323Domain d1dthb_: 1dth B: [40325]
    complexed with ca, dsx, zn

Details for d1dthb_

PDB Entry: 1dth (more details), 2 Å

PDB Description: metalloprotease
PDB Compounds: (B:) atrolysin c

SCOP Domain Sequences for d1dthb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dthb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1dthb_:

Click to download the PDB-style file with coordinates for d1dthb_.
(The format of our PDB-style files is described here.)

Timeline for d1dthb_: