Lineage for d1dtha_ (1dth A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135791Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 135792Protein Snake venom metalloprotease [55520] (4 species)
  7. 135803Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 135806Domain d1dtha_: 1dth A: [40324]

Details for d1dtha_

PDB Entry: 1dth (more details), 2 Å

PDB Description: metalloprotease

SCOP Domain Sequences for d1dtha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtha_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1dtha_:

Click to download the PDB-style file with coordinates for d1dtha_.
(The format of our PDB-style files is described here.)

Timeline for d1dtha_: