Lineage for d7l0fb_ (7l0f B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762280Domain d7l0fb_: 7l0f B: [402664]
    Other proteins in same PDB: d7l0fa_, d7l0fe_, d7l0fg_, d7l0fl_
    automated match to d3uyod_
    complexed with gsp, mg

Details for d7l0fb_

PDB Entry: 7l0f (more details), 1.98 Å

PDB Description: monobody 12vc3 bound to hras(wt)
PDB Compounds: (B:) Monobody 12VC3

SCOPe Domain Sequences for d7l0fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7l0fb_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svptklevvaatptslliswdapavtvffyiiaygetghgvgafqafrvpgskstatisg
lkpgvdytitvyargyskqgpykpspisinyrt

SCOPe Domain Coordinates for d7l0fb_:

Click to download the PDB-style file with coordinates for d7l0fb_.
(The format of our PDB-style files is described here.)

Timeline for d7l0fb_: