SCOPe 2.08: Domain d7l0fb_: 7l0f B:

Lineage for d7l0fb_ (7l0f B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d7l0fb_: 7l0f B: [402664]
   Other proteins in same PDB: d7l0fa_, d7l0fe_, d7l0fg_, d7l0fl_
   automated match to d3uyod_
   complexed with gsp, mg

Details for d7l0fb_

PDB Entry: 7l0f, 1.98 Å

PDB Description: monobody 12vc3 bound to hras(wt)

PDB Compounds: (B:) Monobody 12VC3

SCOPe Domain Sequences for d7l0fb_:

Sequence; same for both SEQRES and ATOM records:

>d7l0fb_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svptklevvaatptslliswdapavtvffyiiaygetghgvgafqafrvpgskstatisg
lkpgvdytitvyargyskqgpykpspisinyrt

Timeline for d7l0fb_:

• d7l0fb_ first appeared in SCOPe 2.07