Lineage for d1egwd_ (1egw D:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259811Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 259812Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 259813Family d.88.1.1: SRF-like [55456] (3 proteins)
  6. 259818Protein Mef2a core [55461] (1 species)
  7. 259819Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 259823Domain d1egwd_: 1egw D: [40237]
    protein/DNA complex

Details for d1egwd_

PDB Entry: 1egw (more details), 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna

SCOP Domain Sequences for d1egwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egwd_ d.88.1.1 (D:) Mef2a core {Human (Homo sapiens)}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytey

SCOP Domain Coordinates for d1egwd_:

Click to download the PDB-style file with coordinates for d1egwd_.
(The format of our PDB-style files is described here.)

Timeline for d1egwd_: