SCOP 1.63: Domain d1srsb_: 1srs B:

Lineage for d1srsb_ (1srs B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (3 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)

8. Domain d1srsb_: 1srs B: [40231]
   protein/DNA complex; complexed with ido

Details for d1srsb_

PDB Entry: 1srs, 3.2 Å

PDB Description: serum response factor (srf) core complexed with specific sre dna

SCOP Domain Sequences for d1srsb_:

Sequence; same for both SEQRES and ATOM records:

>d1srsb_ d.88.1.1 (B:) Serum response factor (SRF) core {Human (Homo sapiens)}
trgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytfat
rklqpmitsetgkaliqtcl

Timeline for d1srsb_:

• d1srsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1srsb_ appears in SCOP 1.61
  
• d1srsb_ appears in SCOP 1.65
  
• d1srsb_ appears in the current release, SCOPe 2.08