SCOPe 2.07: Domain d7lnnb1: 7lnn B:2-101

Lineage for d7lnnb1 (7lnn B:2-101)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries)

8. Domain d7lnnb1: 7lnn B:2-101 [402289]
   Other proteins in same PDB: d7lnna3, d7lnnb3
   automated match to d1mxaa1
   complexed with edo, mg, po4, ppk

Details for d7lnnb1

PDB Entry: 7lnn, 2.5 Å

PDB Description: e. coli s-adenosyl methionine transferase co-crystallized with guanosine-5'-imidotriphosphate

PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7lnnb1:

Sequence; same for both SEQRES and ATOM records:

>d7lnnb1 d.130.1.0 (B:2-101) automated matches {Escherichia coli [TaxId: 1268998]}
khlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsaw
vdieeitrntvreigyvhsdmgfdanscavlsaigkqspd

Timeline for d7lnnb1:

• d7lnnb1 is new in SCOPe 2.07-stable
  
• d7lnnb1 appears in the current release, SCOPe 2.08