Lineage for d7lnna1 (7lnn A:2-99)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583060Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries)
  8. 2583081Domain d7lnna1: 7lnn A:2-99 [402282]
    Other proteins in same PDB: d7lnna3, d7lnnb3
    automated match to d1mxaa1
    complexed with edo, mg, po4, ppk

Details for d7lnna1

PDB Entry: 7lnn (more details), 2.5 Å

PDB Description: e. coli s-adenosyl methionine transferase co-crystallized with guanosine-5'-imidotriphosphate
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7lnna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lnna1 d.130.1.0 (A:2-99) automated matches {Escherichia coli [TaxId: 1268998]}
khlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsaw
vdieeitrntvreigyvhsdmgfdanscavlsaigkqs

SCOPe Domain Coordinates for d7lnna1:

Click to download the PDB-style file with coordinates for d7lnna1.
(The format of our PDB-style files is described here.)

Timeline for d7lnna1: