SCOP 1.57: Domain d1lvl_3: 1lvl 336-458

Lineage for d1lvl_3 (1lvl 336-458)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein Dihydrolipoamide dehydrogenase [55436] (7 species)

7. Species Pseudomonas putida [TaxId:303] [55437] (1 PDB entry)

8. Domain d1lvl_3: 1lvl 336-458 [40205]
   Other proteins in same PDB: d1lvl_1, d1lvl_2

Details for d1lvl_3

PDB Entry: 1lvl, 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution

SCOP Domain Sequences for d1lvl_3:

Sequence; same for both SEQRES and ATOM records:

>d1lvl_3 d.87.1.1 (336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida}
paaiaavcftdpevvvvgktpeqasqqgldcivaqfpfaangramslesksgfvrvvarr
dnhlilgwqavgvavselstafaqslemgacledvagtihahptlgeavqeaalralgha
lhi

Timeline for d1lvl_3:

• d1lvl_3 first appeared (with stable ids) in SCOP 1.55
  
• d1lvl_3 appears in SCOP 1.59
  
• d1lvl_3 appears in the current release, SCOPe 2.08, called d1lvla3