Lineage for d1lvla3 (1lvl A:336-458)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962845Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2962871Species Pseudomonas putida [TaxId:303] [55437] (1 PDB entry)
  8. 2962872Domain d1lvla3: 1lvl A:336-458 [40205]
    Other proteins in same PDB: d1lvla1, d1lvla2
    complexed with fad, nad

Details for d1lvla3

PDB Entry: 1lvl (more details), 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lvla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}
paaiaavcftdpevvvvgktpeqasqqgldcivaqfpfaangramslesksgfvrvvarr
dnhlilgwqavgvavselstafaqslemgacledvagtihahptlgeavqeaalralgha
lhi

SCOPe Domain Coordinates for d1lvla3:

Click to download the PDB-style file with coordinates for d1lvla3.
(The format of our PDB-style files is described here.)

Timeline for d1lvla3: