![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins) |
![]() | Protein Dihydrolipoamide dehydrogenase [55436] (7 species) |
![]() | Species Pseudomonas putida [TaxId:303] [55437] (1 PDB entry) |
![]() | Domain d1lvl_3: 1lvl 336-458 [40205] Other proteins in same PDB: d1lvl_1, d1lvl_2 |
PDB Entry: 1lvl (more details), 2.45 Å
SCOP Domain Sequences for d1lvl_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvl_3 d.87.1.1 (336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida} paaiaavcftdpevvvvgktpeqasqqgldcivaqfpfaangramslesksgfvrvvarr dnhlilgwqavgvavselstafaqslemgacledvagtihahptlgeavqeaalralgha lhi
Timeline for d1lvl_3: