Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species) |
Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries) |
Domain d1d7ya3: 1d7y A:309-400 [40204] Other proteins in same PDB: d1d7ya1, d1d7ya2, d1d7ya4 complexed with fad |
PDB Entry: 1d7y (more details), 2.1 Å
SCOPe Domain Sequences for d1d7ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7ya3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv nnardfaplrrllavgakpdraaladpatdlr
Timeline for d1d7ya3: