PDB entry 1d7y

View 1d7y on RCSB PDB site
Description: crystal structure of nadh-dependent ferredoxin reductase, bpha4
Class: oxidoreductase
Keywords: flavoprotein rossmann fold, oxidoreductase
Deposited on 1999-10-21, released 2000-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin reductase
    Species: Pseudomonas sp. [TaxId:307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d7ya1, d1d7ya2, d1d7ya3, d1d7ya4
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d7yA (A:)
    msqealkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgd
    aekirldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlq
    gatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprl
    msraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlan
    dalaraaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgia
    varhlvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkg
    rivgatcvnnardfaplrrllavgakpdraaladpatdlrklaaavaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d7yA (A:)
    alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki
    rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlqgatm
    pvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprlmsra
    apatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlandala
    raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh
    lvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivg
    atcvnnardfaplrrllavgakpdraaladpatdlrklaaa