Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins) |
Protein NADH peroxidase [55432] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries) |
Domain d1nhp_3: 1nhp 322-447 [40196] Other proteins in same PDB: d1nhp_1, d1nhp_2 |
PDB Entry: 1nhp (more details), 2 Å
SCOP Domain Sequences for d1nhp_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhp_3 d.87.1.1 (322-447) NADH peroxidase {Enterococcus faecalis} gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale avkqer
Timeline for d1nhp_3: