SCOP 1.59: Domain d1nhp_3: 1nhp 322-447

Lineage for d1nhp_3 (1nhp 322-447)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein NADH peroxidase [55432] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries)

8. Domain d1nhp_3: 1nhp 322-447 [40196]
   Other proteins in same PDB: d1nhp_1, d1nhp_2

Details for d1nhp_3

PDB Entry: 1nhp, 2 Å

PDB Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303

SCOP Domain Sequences for d1nhp_3:

Sequence; same for both SEQRES and ATOM records:

>d1nhp_3 d.87.1.1 (322-447) NADH peroxidase {Enterococcus faecalis}
gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp
ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale
avkqer

Timeline for d1nhp_3:

• d1nhp_3 first appeared (with stable ids) in SCOP 1.55
  
• d1nhp_3 appears in SCOP 1.57
  
• d1nhp_3 appears in SCOP 1.61
  
• d1nhp_3 appears in the current release, SCOPe 2.08, called d1nhpa3