SCOPe 2.08: Domain d7dada2: 7dad A:246-438

Lineage for d7dada2 (7dad A:246-438)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d7dada2: 7dad A:246-438 [401952]
Other proteins in same PDB: d7dada1, d7dadb1, d7dadc1, d7dadd1, d7dade_, d7dadf1, d7dadf2, d7dadf3
automated match to d4i50a2
complexed with acp, ca, cl, epd, gdp, gtp, mes, mg

Details for d7dada2

PDB Entry: 7dad (more details), 2.85 Å

PDB Description: epd in complex with tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d7dada2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dada2 d.79.2.1 (A:246-438) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

SCOPe Domain Coordinates for d7dada2:

Click to download the PDB-style file with coordinates for d7dada2.
(The format of our PDB-style files is described here.)

Timeline for d7dada2: