Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries) |
Domain d7dade_: 7dad E: [402074] Other proteins in same PDB: d7dada1, d7dada2, d7dadb1, d7dadb2, d7dadc1, d7dadc2, d7dadd1, d7dadd2, d7dadf1, d7dadf2, d7dadf3 automated match to d4i55e_ complexed with acp, ca, cl, epd, gdp, gtp, mes, mg |
PDB Entry: 7dad (more details), 2.85 Å
SCOPe Domain Sequences for d7dade_:
Sequence, based on SEQRES records: (download)
>d7dade_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d7dade_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d7dade_: