Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries) |
Domain d7by9c1: 7by9 C:1-146 [401769] Other proteins in same PDB: d7by9a2, d7by9b2, d7by9c2, d7by9d2 automated match to d3tl2a1 complexed with nad, oaa |
PDB Entry: 7by9 (more details), 2.2 Å
SCOPe Domain Sequences for d7by9c1:
Sequence, based on SEQRES records: (download)
>d7by9c1 c.2.1.0 (C:1-146) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} amkrkkisvigagftgattafllaqkelgdvvlvdipqlenptkgkaldmleaspvlgfd aniigtsdyadtadsdivvitagiarkpgmsrddlvttnqkimkqvtkevvkyspncyii vltnpvdamtytvfkesgfpknrvig
>d7by9c1 c.2.1.0 (C:1-146) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} amkrkkisvigagftgattafllaqkelgdvvlvdipqlenptkgkaldmleaspvlgfd aniigtsdyadtadsdivvitagialvttnqkimkqvtkevvkyspncyiivltnpvdam tytvfkesgfpknrvig
Timeline for d7by9c1: