Lineage for d7ackd1 (7ack D:176-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718133Domain d7ackd1: 7ack D:176-309 [401692]
    Other proteins in same PDB: d7acka1, d7acka2, d7ackc1, d7ackc2
    automated match to d1h1pb1
    complexed with edo, na, no3, r7b

Details for d7ackd1

PDB Entry: 7ack (more details), 1.8 Å

PDB Description: cdk2/cyclin a2 in complex with an imidazo[1,2-c]pyrimidin-5-one inhibitor
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d7ackd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ackd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d7ackd1:

Click to download the PDB-style file with coordinates for d7ackd1.
(The format of our PDB-style files is described here.)

Timeline for d7ackd1: